PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010919874.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family NAC
Protein Properties Length: 361aa    MW: 40885 Da    PI: 5.0536
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010919874.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM166.97.1e-5251321128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                     lppGfrFhPtd+elv +yLkkkv+g k++l evi+ +++yk++Pw+Lp k  + +++ ew+fF++rd+ky++g+r+nrat+sgyWkatg+d++++
  XP_010919874.1   5 LPPGFRFHPTDDELVGYYLKKKVDGIKFDL-EVIPLIELYKFDPWELPdKsFLPKRDMEWFFFCPRDRKYPNGSRTNRATASGYWKATGRDRKII 98 
                     79****************************.99**************96434556788************************************* PP

             NAM  94 skkgelvglkktLvfykgrapkgektdWvmheyrl 128
                     + ++++ gl+ktLvfy+grap ge+tdWvmheyrl
  XP_010919874.1  99 C-ESSVHGLRKTLVFYRGRAPGGERTDWVMHEYRL 132
                     *.9999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.44E-563136IPR003441NAC domain
PROSITE profilePS5100552.7975149IPR003441NAC domain
PfamPF023656.8E-296132IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 361 aa     Download sequence    Send to blast
MSLSLPPGFR FHPTDDELVG YYLKKKVDGI KFDLEVIPLI ELYKFDPWEL PDKSFLPKRD  60
MEWFFFCPRD RKYPNGSRTN RATASGYWKA TGRDRKIICE SSVHGLRKTL VFYRGRAPGG  120
ERTDWVMHEY RLCEYRSDGS SNFVKIGDLQ GESRARKGHS SAMTDFSPKM CFSNVLSTSE  180
ENQSVVIDLN RSNGSTRSNS LENLRGNELH QIMIDSDQTD LCRSRVVSDA SKVSSPKEGI  240
SESMITNVFP SSIEICTPCN PSPFSSCENF REEAYMIDEL NGHGCSSSCP SPVYCMDMFS  300
SVEDITLQSL EWDTPKYMNA SSSVAGIETW NPVFPPPICR QASVGEEVNL WFQDDSMVIV  360
N
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-52214314154NO APICAL MERISTEM PROTEIN
1ut4_B2e-52214314154NO APICAL MERISTEM PROTEIN
1ut7_A2e-52214314154NO APICAL MERISTEM PROTEIN
1ut7_B2e-52214314154NO APICAL MERISTEM PROTEIN
3swm_A2e-52214317157NAC domain-containing protein 19
3swm_B2e-52214317157NAC domain-containing protein 19
3swm_C2e-52214317157NAC domain-containing protein 19
3swm_D2e-52214317157NAC domain-containing protein 19
3swp_A2e-52214317157NAC domain-containing protein 19
3swp_B2e-52214317157NAC domain-containing protein 19
3swp_C2e-52214317157NAC domain-containing protein 19
3swp_D2e-52214317157NAC domain-containing protein 19
4dul_A2e-52214314154NAC domain-containing protein 19
4dul_B2e-52214314154NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010919874.10.0PREDICTED: NAC transcription factor 25-like isoform X2
TrEMBLM0RT581e-120M0RT58_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr11P17780_0011e-120(Musa acuminata)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17980.17e-75NAC domain containing protein 71